PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_016280-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 335aa    MW: 37404.9 Da    PI: 6.6923
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_016280-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +++ +v  +G g+W+ ++++ g++R++k+c++rw +yl
  AHYPO_016280-RA 14 KGIWTPEEDAKILAYVSNHGVGNWTQVPKKAGLNRCGKSCRLRWTNYL 61
                     678*******************************************97 PP

2Myb_DNA-binding47.73.5e-1569110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +T++E+ l++++++  G++ W++Ia++++ gRt++++k++w++
  AHYPO_016280-RA  69 EFTEQEQHLIIQYHAAIGSR-WSLIAKHLP-GRTDNDVKNYWNT 110
                      69******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-25564IPR009057Homeodomain-like
PROSITE profilePS5129425.577965IPR017930Myb domain
SuperFamilySSF466898.8E-3111108IPR009057Homeodomain-like
SMARTSM007171.3E-141363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001676.17E-111761No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129418.43666116IPR017930Myb domain
SMARTSM007171.6E-1366114IPR001005SANT/Myb domain
CDDcd001671.35E-969112No hitNo description
PfamPF002493.0E-1469110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGRPPCCDKA NVKKGIWTPE EDAKILAYVS NHGVGNWTQV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHEEF TEQEQHLIIQ YHAAIGSRWS LIAKHLPGRT DNDVKNYWNT KLKKKLAKMG  120
IDPVTHKPIS KILSDYESIS CLTTNGQMRS VDKTLADSFS SRCRLSPSIH LGSESSAAMS  180
WMPMIDQLHE ITSFNHCMLD QVSPSSTSSS SSSISNGQSS SHLLVPASYS WGEKNSSVDD  240
CLFDSDITEQ EHNYSGFLAK DSQTHILENS SQTSSKIKDD KFELSDCKKA GENAEASRCY  300
DSEPSSVNLF VKALLDRDSE IQLDFPAFHD ILDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010670356.11e-162PREDICTED: protein ODORANT1
TrEMBLA0A0K9R4931e-171A0A0K9R493_SPIOL; Uncharacterized protein
STRINGGLYMA13G04920.17e-90(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.14e-76MYB family protein